PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G096400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 295aa    MW: 32450.4 Da    PI: 9.5699
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G096400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.92.4e-082973346
                        SS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqk 46
                         WT++E +l+ +a +    +  +W+ +ar ++ gRt  ++++++ +
  Sevir.5G096400.1.p 29 TWTPQENKLFERALAGVDLRcpDWEQVARAIP-GRTVREVVHHFKS 73
                        6**************9888888**********.**********986 PP

2Myb_DNA-binding48.12.6e-15142186347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE++l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
  Sevir.5G096400.1.p 142 PWTEEEHKLFLLGLKKYGKGDWRNISRNFVQTRTPTQVASHAQKY 186
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.6022579IPR017884SANT domain
SMARTSM007172.4E-42677IPR001005SANT/Myb domain
SuperFamilySSF466892.51E-82879IPR009057Homeodomain-like
PfamPF002493.5E-62974IPR001005SANT/Myb domain
CDDcd001675.24E-72974No hitNo description
PROSITE profilePS5129418.359135191IPR017930Myb domain
SuperFamilySSF466896.28E-18136191IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-17138189IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.2E-12139185IPR009057Homeodomain-like
SMARTSM007173.4E-13139189IPR001005SANT/Myb domain
PfamPF002499.9E-13142186IPR001005SANT/Myb domain
CDDcd001677.66E-12142187No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MMREAYMEVL PPMDHIGSRN GWYHPAVRTW TPQENKLFER ALAGVDLRCP DWEQVARAIP  60
GRTVREVVHH FKSLEVDVQQ IESGMVPIPF YGGGGGGSFT LQWDGNGGGG PGDFRHAYRF  120
GGGCGKRHPG RTPEQERKKG VPWTEEEHKL FLLGLKKYGK GDWRNISRNF VQTRTPTQVA  180
SHAQKYFIRL NSGGKDKRRS SIHDITTVNL TDDQPPSPSQ SSLITNQSNA SAPATAVGQF  240
SLSADTKQHG AANLPFNSPS RTPGMPTYGM GLQDQGLQCG PLHDQLVGNQ SMLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-142896978RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968168.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-82DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLK3XKK30.0K3XKK3_SETIT; Uncharacterized protein
STRINGSi002426m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.17e-62MYB family protein